PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00042.1.g00140.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 268aa    MW: 29481.5 Da    PI: 8.5706
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00042.1.g00140.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM106.63e-3327554128
                           NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   +ekewyfFs rd+ky+tg r+nrat+sgyWk+tgkdke+++  g lvg+kktLvfy+grapkgekt+Wvmheyrl
  Zpz_sc00042.1.g00140.1.am.mk   2 GEKEWYFFSMRDRKYPTGIRTNRATDSGYWKTTGKDKEIFH-CGMLVGMKKTLVFYRGRAPKGEKTSWVMHEYRL 75 
                                   579**************************************.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100541.526196IPR003441NAC domain
SuperFamilySSF1019415.23E-39296IPR003441NAC domain
PfamPF023651.4E-15675IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MGEKEWYFFS MRDRKYPTGI RTNRATDSGY WKTTGKDKEI FHCGMLVGMK KTLVFYRGRA  60
PKGEKTSWVM HEYRLQNKFP YNPNKEEWVV CRVFKKCQII KMRPPTDSPT MGSPCHDGNQ  120
SLGELGELDV SSILGSLTPA SMHTSSSSPG EGFGHRMDMN AYLSWMAAAN QGAVAAATAA  180
MLPWATAPGL FSNVFAAPSP LGQKSLPYAG CSSSQPRDIS GVVANIGGDH AMFGSSVAKV  240
DMECDRQQQA PTPPEQQPGM DESTWRAF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B4e-3319668165NAC domain-containing protein 19
4dul_A4e-3319668165NAC domain-containing protein 19
1ut7_B4e-3319668165NO APICAL MERISTEM PROTEIN
1ut7_A4e-3319668165NO APICAL MERISTEM PROTEIN
1ut4_B4e-3319668165NO APICAL MERISTEM PROTEIN
1ut4_A4e-3319668165NO APICAL MERISTEM PROTEIN
3swp_D5e-3319671168NAC domain-containing protein 19
3swp_C5e-3319671168NAC domain-containing protein 19
3swp_B5e-3319671168NAC domain-containing protein 19
3swp_A5e-3319671168NAC domain-containing protein 19
3swm_D5e-3319671168NAC domain-containing protein 19
3swm_C5e-3319671168NAC domain-containing protein 19
3swm_B5e-3319671168NAC domain-containing protein 19
3swm_A5e-3319671168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3631710.0AK363171.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013D22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982400.11e-126PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
TrEMBLK4ACC81e-126K4ACC8_SETIT; Uncharacterized protein
STRINGSi036535m1e-126(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.13e-58NAC domain containing protein 58